PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00650g07003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 258aa    MW: 29596.2 Da    PI: 4.1292
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00650g07003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.17.4e-211557244
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                              +ien  nr vtfskRr+g++KKA+EL+++C++e+a++ f+++ 
  Peinf101Scf00650g07003.1 15 KIENWWNRRVTFSKRREGLFKKASELCIMCGIEIAIVTFAPNS 57
                              69*************************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.306657IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-22666IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-25780IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-14828IPR002100Transcription factor, MADS-box
PfamPF003196.8E-201563IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-142843IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-144364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MPRVSRGRKK VEITKIENWW NRRVTFSKRR EGLFKKASEL CIMCGIEIAI VTFAPNSMKV  60
YSFGHPSVYE MVDRYLARHP PGDDEHEEGE AEEEKVDGDD DDDDGDDEDD EEDDDYDDDA  120
VYDIDDDDDD DSNGNGVNPE FVEAYRNVSI TRIANELMAK EDELAREIKR GKELETVRKE  180
SGSDPQNWWE APIAKLNYDQ LQEVMEAMKT AQEKVEREAE RLKMEKENIK FPYSNFGSAL  240
APRQNFDANE PSGSGSTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2501622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-26AGAMOUS-like 62